PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_19703_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 167aa    MW: 19307.5 Da    PI: 10.061
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_19703_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.21.9e-181964148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         rg++++eE++ +++++  lG++ W+tIa +++ gRt++++k++w+++l
  cra_locus_19703_iso_1_len_498_ver_3 19 RGKFSPEEEQTILNLHSVLGNK-WSTIATHLP-GRTDNEIKNFWNTHL 64
                                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500903.938113IPR017877Myb-like domain
SuperFamilySSF466898.36E-22270IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.8E-10224IPR009057Homeodomain-like
PROSITE profilePS5129427.3761468IPR017930Myb domain
SMARTSM007172.6E-161866IPR001005SANT/Myb domain
PfamPF002499.4E-171964IPR001005SANT/Myb domain
CDDcd001672.08E-122164No hitNo description
Gene3DG3DSA:1.10.10.605.2E-242568IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
XGKSCRLRWT NYLRPDIKRG KFSPEEEQTI LNLHSVLGNK WSTIATHLPG RTDNEIKNFW  60
NTHLKKKLIQ NGIDPITHRP APPTATTWPH LIALSSNLND IIQQYSLQKQ MAANLQYYLQ  120
YLLQPPPPPP LLLEPSNMPP ATSSSYNNNI IVNYHEQKQK QQQQQQX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-2026842108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010027860.13e-61PREDICTED: transcription factor MYB34-like
SwissprotO496081e-41MYB32_ARATH; Transcription factor MYB32
TrEMBLA0A059AKZ83e-61A0A059AKZ8_EUCGR; Uncharacterized protein
STRINGPOPTR_0007s05360.17e-59(Populus trichocarpa)